PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03421g05004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 228aa    MW: 25774.7 Da    PI: 7.3586
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03421g05004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.72.4e-3252107460
               ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                rY+eClkNhA+ +Gg+avDGCgEf+p+ ge gt +alkCaAC+CHRnFHR+eve e
  Niben101Scf03421g05004.1  52 PRYRECLKNHAVGIGGQAVDGCGEFLPA-GEAGTLDALKCAACNCHRNFHRKEVEGE 107
                               69*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-2253105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-2953104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.1E-2953104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.80354103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.75E-20150226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-31155227IPR009057Homeodomain-like
TIGRFAMsTIGR015651.4E-24166221IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEFGDEHEDQ EEEIANIFQI PATTENNYQD FGEGGQISRT AATLRKNNVP SPRYRECLKN  60
HAVGIGGQAV DGCGEFLPAG EAGTLDALKC AACNCHRNFH RKEVEGEILN FHHPIPPPTL  120
HHPPHHYPYR YLQRPLALPS ITSREDIEDY VSNPSSSGGG GSGSSKRFRT KFTQDQKEKM  180
FAFAERLGWR IQKENEAAVQ QFCAETNIRR QVFKVWMHNN KHTLGKKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-271642231675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772007.11e-141PREDICTED: zinc-finger homeodomain protein 2-like
RefseqXP_016482443.11e-141PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9SB612e-71ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA5BZD75e-75A5BZD7_VITVI; Putative uncharacterized protein
TrEMBLF6H1069e-76F6H106_VITVI; Putative uncharacterized protein
TrEMBLM1AZE81e-75M1AZE8_SOLTU; Uncharacterized protein
STRINGVIT_18s0001g07140.t013e-75(Vitis vinifera)
STRINGPGSC0003DMT4000336244e-75(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-62homeobox protein 22